• Antimikrobielle Peptider

    Velkommen til projektet Find fremtidens antibiotika!

    Projektet er sponsoreret af Novozymes A/S og Institut for Systembiologi. Emma C. Jappe har udarbejdet undervisningsmaterialet på baggrund af det tidligere projekt omkring antimikrobielle peptider, der blev udarbejdet af Thomas Rasmussen.

    Formålet med dette undervisningsprojekt er at give en forståelse af, hvad antimikrobielle peptider er, og hvorfor de muligvis er fremtidens antibiotika. Idet gennemgangen og forståelsen af en række teoretiske emner vil gøre det nemmere at forstå, hvad antimikrobielle peptider er, og hvordan de udøver deres effekt på bakterieceller, består dette undervisningsprojekt desuden af artikler, der gennemgår den nødvendige teori. En oversigt over artiklerne, der ved gennemgang giver en dybere forståelse for antimikrobielle peptider og teorien bag dem, ses nedenfor:

    • Prokaryoter, eukaryoter og den biologiske cellemembran
    • Inddeling af bakterier i Gram positive og Gram negative
    • Lægemiddeludvikling og antimikrobielle peptider
    • Proteinstruktur og de 20 aminosyrer
    • Resistens og mutationer
    • Signalpeptider og propeptider

    Det er ikke nødvendigt at læse de teoretiske artikler i en bestemt rækkefølge, og de kan desuden læses uafhængigt af hinanden. Arbejdet med dette undervisningsprojekt kan indledes med at læse case-artiklen Historien om mirakelmedicin fra en lille sort svamp. Herefter kan der tages udgangspunkt i hovedartiklen om antimikrobielle peptider Antimikrobielle peptider: Historie, fremkomst og fremtid, hvorfra man kan navigere sig ind på det teoretiske materiale, hvor det er relevant.

    God fornøjelse med projektet!

  • Indledende case: Plectasin

    Historien om mirakelmedicin fra en lille sort svamp

    Nutidens store forbrug af antibiotika har bevirket, at antallet af antibiotikaresistente bakterier er steget kraftigt de seneste år. Problemer med multiresistente bakterier vokser, og dette kan i høj grad begrænse mulighederne for i fremtiden at bekæmpe bakterielle infektioner. Flere læger og forskere er bange for, at vi er ved at træde ind i en såkaldt post-antibiotika æra, hvilket betyder, at antibiotika ikke længere har nogen effekt, fordi alle bakterier er blevet resistente. I dag forskes der derfor i måder, hvorpå man kan bekæmpe bakterier, der enten allerede er blevet resistente over for antibiotika på markedet eller kan risikere at blive resistente. Det kræver dog både tid og penge at få et nyt antibiotikum på markedet, og et potentielt antibiotisk stof vil ikke altid kunne opfylde de strenge krav, som medicinalindustrien stiller.

    I 2005 blev der i tidsskriftet Nature udgivet en artikel omkring et lille vidunderstof, der viste sig at være effektivt mod multiresistente bakterier. Forskere fra Novozymes stod bag dette sensationelle fund af et meget lovende antibiotikum. Det antibiotiske stof, navngivet Plectasin, findes i den lille sorte svamp Pseudoplectania Nigrella og er et antimikrobielt peptid, dvs. et lille bakteriedræbende protein. Plectasin beskrives af Novozymes som værende epokegørende og skelsættende, idet det har vist sig at have stort potentiale i behandlingen af ellers resistente bakterier. Det antimikrobielle peptid har vist sig at være effektivt i bekæmpelsen af infektioner, idet peptidet bl.a. er effektivt over for bakterien Streptococcus pneumoniae, der kan forårsage dødelig lungebetændelse. Derudover ses også lovende resultater over for Staphylococcus, som er en almindelig bakterie i sårinfektioner. Plectasin er ikke toksisk over for mennesker og fremkalder ikke krydsresistens, hvilket betyder, at bakterier, som eventuelt bliver resistente over for Plectasin, ikke samtidig bliver resistente over for andre kemisk beslægtede antibiotika.

    Der var ingen forskere på udkig efter Plectasin, da det i midten af 2002 blev fundet ved en tilfældighed. Kirk Matthew Schnorr var forskeren, der fandt Plectasin. Han var oprindeligt på udkig efter enzymer i P. Nigrella, hvortil han benyttede bioinformatik til at sammenligne forskellige gensekvenser, som kodede for enzymer og andre proteiner. De benyttede metoder kunne identificere enzymer og andre proteiner, der havde en signalsekvens. Disse signalsekvenser medfører, at det færdige protein vil blive transporteret ud af cellen. Når proteiner bliver transporteret ud af P. Nigrella skyldes dette, at nogle proteiner virker uden for cellen, idet de bruges til at bekæmpe andre mikroorganismer. Da antimikrobielle peptider (AMP’er) udøver deres effekt uden for cellen, har de derfor en signalsekvens. AMP’er som Plectasin transporteres ud af P. Nigrella, idet de er i stand til at dræbe konkurrerende mikroorganismer, hvilket er en fordel for svampen. Gennem brugen af bioinformatik fandt Kirk Matthew Schnorr en DNA-sekvens, der kodede for et lille protein af typen defensin. Defensiner er forsvarsstoffer, der er velkendt fra mennesker, dyr og højerestående planter. DNA-sekvensen blev videregivet til et Novozymes-team med forsker Hans-Henrik Kristensen i spidsen. Forskerne i dette team, der dagligt havde fokus på arbejdet med antimikrobielle peptider, kunne allerede efter få forsøg se, hvor lovende det lille peptid var.

    Novozymes opdagede tidligt, at Plectasin havde en meget interessant og unik virkningsmekanisme, idet det ikke opførte sig på samme måde som andre antibiotika eller AMP’er. De fleste AMP’ers primære virkningsmekanisme ligger i deres evne til at binde sig til bakterielle cellemembraner og lave huller i dem, og da cellen ikke kan overleve længe uden en intakt cellemembran, vil celledød forekomme næsten øjeblikkeligt. Plectasin demonstrerer dog ikke denne effekt. Peptidet angriber i stedet bakteriens cellevæg. På denne måde vil det ikke have nogen toksisk effekt på mennesker, hvilket skyldes, at de eukaryote celler, som mennesker består af, ikke har nogen cellevæg. Herved vil Plectasin kun angribe bakterieceller, hvorved det opfylder et af de vigtige kriterier, der stilles til lægemidler. Den præcise måde, hvorpå Plectasin virker, kan beskrives ved kort at gennemgå bakteriens opbygning. Alle bakterier består af en cellemembran samt en stiv cellevæg uden på membranen, der beskytter cellen mod fremmede stoffer. Inde i cellen er der DNA, der koder for al den information, der er nødvendig for at opretholde liv. Derved koder DNA også for byggestenene til den beskyttende cellevæg. Da DNA’et findes inde i cellen, vil byggestenene, der udgør cellevæggen, også dannes inde i cellen. Disse skal dog transporteres hen til cellemembranen og gennem denne for at nå ud til det sted, hvor de skal bruges; nemlig uden for cellen. Transporten af cellevæggens byggestene ud af cellen udføres af molekylet lipid II. Det er her, at Plectasin kommer ind i billedet. Plectasin har nemlig vist sig at binde til og isolere lipid II, hvorved transporten af byggestenene ud gennem cellemembranen forhindres. Dette forhindrer biosyntesen af cellevæggen, og uden en cellevæg vil bakterien dø. Det er ikke klarlagt, om binding til lipid II er den eneste måde, hvorpå Plectasin udøver sin effekt på bakterieceller. Mange andre AMP’er har i flere forsøg demonstreret, at de har flere virkningsmekanismer. Dette er en af grundende til interessen for dem, da det er sværere for bakterier at blive resistente over for multifunktionelle antibiotika.

    Forsøg efter forsøg med Plectasin, og varianter af dette, demonstrerede, hvor effektivt det egentlig var. Det viste stor aktivitet over for patogene (sygdomsfremkaldende) bakterier i slægterne Streptococcus og Staphylococcus. Alle bakterier i disse slægter er Gram-positive bakterier. Gram-positive bakterier er en af de to typer af bakterier (Gram-positive og Gram-negative), der findes. Plectasin er derved effektivt over for Gram-positive bakterier som Streptococcus pneumoniae, men dog ikke over for Gram-negative bakterier. Ingen af de testede Gram-positive bakterier var resistente over for Plectasin, som desuden viste sig at have en unik virkningsmekanisme, der ikke var blevet set før hos andre antibiotika. Plectasin er bakteriocidalt (bakteriedræbende) og viser sig, i modsætning til nogle andre AMP’er, at være salttolerant. Dette betyder blandt andet, at det forbliver stabilt, når det kommer i kontakt med blod. I forsøg med mus tydede det på, at Plectasin kunne komme godt rundt i kroppen, og peptidet havde en halveringstid på ca. en halv time, hvorved det i mennesker formodentligt vil have haft en halveringstid på 4-8 timer. Plectasin ville på denne måde befinde sig i kroppen længe nok til at udøve sin effekt. En sidste vigtig ting, der bør nævnes er, at kun en lille koncentration af Plectasin er nok til at virke bakteriedræbende, mens en koncentration, der er omkring 1000 gange så høj, kræves for at dræbe menneskers røde blodlegemer. Herved er der stor forskel på den effektive dosis og den toksiske dosis, hvilket er en vigtig faktor i lægemiddeludvikling.

    Plectasin fik stor opmærksomhed efter opdagelsen, og i 2008 solgte Novozymes rettighederne til udvikling, registrering og markedsføring af peptidet til et stort medicinalfirma. Det videre forløb bestod i at udføre kliniske studier med peptidet, dvs. studier af dets effekt i mennesker. De mange fordele, som Plectasin viste sig at have, gør det svært at forstå, at medicinalfirmaet i 2010 endte med at droppe projektet. Hvad gik der galt?

    Lægemiddeludviklingsprocessen er en lang og sej proces, og det tager i gennemsnit 14 år og koster 3 milliarder kroner at få et lægemiddel på markedet. Plectasin kom med succes igennem den første række af prekliniske studier, men nåede aldrig ind i de meget dyre og omfattende kliniske studier. Som tidligere nævnt virker Plectasin kun på Gram-positive bakterier, og da der er større behov for antibiotika, der bekæmper Gram-negative bakterier, var dette en afgørende faktor i beslutningen om, hvorvidt der skulle lægges millioner af kroner i kliniske studier med Plectasin. Plectasin er desuden ret dyrt sammenlignet med andre antibiotika og minder tilsyneladende for meget om antibiotikummet vancomycin, der allerede er på markedet. Plectasin ville ikke kunne indtages i form af tabletter, idet tarmen dårligt optager hele proteiner og peptider, da enzymer, kaldet proteaser, vil nedbryde disse til aminosyrer, så de nemmere kan optages. Proteasens effekt er således uheldig i denne henseende, men man bør huske på, at proteaser er livsvigtige for vores fordøjelse og optag af næring.

    Som det fremgår af ovenstående skulle Plectasin have været langt bedre for at være blevet taget i betragtning. Hele 8 år efter den tilfældige opdagelse af det lille lovende peptid, blev det droppet, hvilket illustrerer, hvor strenge krav medicinalindustrien stiller. Selvom resistens er et stigende problem, skal der meget til for, at et firma vil lægge penge i et antibiotikaudviklingsprojekt. Ingen ved og vil heller ikke komme til at finde ud af, hvor langt Plectasin ville være nået i udviklingsprocessen, hvis medicinalfirmaet i 2010 ikke havde droppet det.

    Plectasin var et godt bud på et nyt antibiotikum med en unik virkningsmekanisme, men der er stadig lang vej endnu. Jagten efter fremtidens antibiotika er stadig i fuld gang.

  • Antimikrobielle peptider – historie

    Antimikrobielle peptider: Historie, fremkomst og fremtid

    Antimikrobielle peptider (AMP’er) har altid været en del af os. De findes i vores immunceller, er en komponent i sved, spyt, urin og brystmælk og befinder sig på vores hud. De er livsvigtige for os og udgør en betydelig del af vores immunsystem, idet de fungerer som en vigtig forsvarsmekanisme over for patogene mikroorganismer, såsom bakterier og vira. AMP’er har altid været en vigtig del af vores immunforsvar, men forskere er først i løbet af de seneste år begyndt at undersøge deres potentiale som fremtidens antibiotika.

    Før vi kan begive os ned i en dybere undersøgelse af AMP’er for at forstå årsagen til den store interesse for dem, skal vi starte med at spole tiden tilbage til 1670’erne. I denne periode blev bakterier, der er encellede mikroorganismer, opdaget af Anton Van Leeuwenhoek efter hans opfindelse af mikroskopet (se figur 1). Først 200 år efter opdagelsen af bakterien, fandt man ud af, at nogle af disse forårsagede sygdomme så som tuberkulose, kolera og pneumoni. Disse sygdomme skabte store problemer, idet de var svære at behandle, og det blev derved til en mission at finde antibakterielle stoffer, der kunne bekæmpe de patogene bakterier enten ved at hæmme væksten af dem eller ved at dræbe dem.

    Figur 1Anton van Leeuwenhoek er en vigtig figur inden for biologien. Omkring år 1688 designede han mikroskoper, som var inspireret af Robert Hookes simple mikroskoper i værket Micrographia. Derudover var van Leeuwenhoek den første der opdagede bakterier.

    I starten af 1900-tallet blev der brugt meget tid og mange penge på forskning i antibakterielle stoffer. På trods af dette blev verdens første naturlige, og derved ikke syntetisk fremstillede, antibiotikum faktisk opdaget ved en tilfældighed. Dette antibiotikum var penicillin. Man havde inden opdagelsen ikke overvejet, at antibakterielle stoffer kunne produceres af mikroorganismer selv, dvs. bakterier og svampe, hvilket viste sig at være tilfældet med penicillin, som produceres af svampeslægten Penicillum. Opdagelsen af penicillin satte for alvor gang i antibiotikaforskningen, og især efter 2. verdenskrig kom der mange nye og effektive antibiotika på markedet. Antibakterielle stoffers store succes skyldes, at de er selektive over for bakterielle celler. Dette betyder, at de kun er effektive over for bakterieceller, mens de ingen effekt har på humane celler. Denne selektivitet kommer af, at der er stor forskel på bakterieceller, der er prokaryoter, og menneskeceller, der hører til de eukaryote celler (se figur 2 samt uddybende artikel om celletyper og deres membraner).

    Figur 2En prokaryot celle er relativ simpel i forhold til en eukaryot celle, idet prokaryoten hverken har en cellekerne eller organeller. Derudover har bakterier en cellevæg, hvilket ikke gør sig gældende for humane celler.

    Ved at kende til forskellene på bakterie- og menneskeceller er det muligt at finde og designe lægemidler, der effektivt rammer bakterier uden at påvirke resten af kroppen. Dermed undgår man bivirkninger ved medicinen, som kan være til gene for patienten. Målet med designet er at gå efter mekanismer eller strukturelle egenskaber, der er unikke for bakterier og derfor ikke findes i humane celler. Inden for medicinalkemien siger man, at man leder efter nogle specifikke ’targets’, dvs. mål hos bakterien, som lægemidlet skal angribe. Denne viden om bakteriers ’targets’ er en meget vigtig del af antibiotikadesign. Især i løbet af 1900-tallet er der sket store fremskridt mht., hvordan man bedre kan bekæmpe bakterielle infektioner. Denne udvikling førte til, at en amerikansk kirurg i 1967 udtalte: “The time has come to close the book on infectious diseases. We have basically wiped out infection in the United States”. Dette er desværre i høj grad blevet modbevist efterfølgende, idet der siden udtalelsen er fremkommet mange nye bakterielle infektionssygdomme.

    Men hvordan kan der være fremkommet så mange nye bakterieforårsagede sygdomme, når der er sådan en rig forekomst af antibiotika?

    En lemfældig omgang med antibiotika som en nem og hurtig behandlingsform har medført, at mange bakterier enten har været udsat for så små mængder af antibiotika, at det ikke har dræbt alle bakterierne, eller for antibiotika, der ikke angriber bakteriens ’targets’. Hvis en bakterie overlever en antibiotikabehandling kan dette enten skyldes, at behandlingen ikke er blevet ført til ende og derved ikke har dræbt eller hæmmet alle bakterierne, eller der kan være forekommet en mutation i et eller flere af bakteriens ’targets’, hvorved bakterien ikke længere kan genkendes af antibiotikummet. Herved bliver bakterien mere modstandsdygtig næste gang den bliver udsat for samme antibiotikum. Dette har ført til en stigende forekomst af resistente bakterier. Bakterier kan udvikle resistens over for flere forskellige typer antibiotika, hvilket kaldes multiresistens.

    Figur 3Antallet af rapporterede tilfælde af methicillin (et antibiotikum) resistente Staphylococcus aureus (MRSA) i Danmark i årene fra 1994 til 2011. Fra DANMAP rapporten fra 2011.

    I dag kan vi i bagklogskabens lys se, at udtalelsen i 1967 var fejlagtig, idet det fortsat er nødvendigt at forske i måder, hvorpå vi kan bekæmpe bakterier, der enten allerede er blevet resistente over for antibiotika på markedet, eller hvor vores antibiotika ikke virker særlig godt. Vi er på udkig efter antibiotika, der gør det sværere for bakterien at blive resistent.

    Netop her kommer antimikrobielle peptider (AMP’er) ind i billedet. Det er nemlig især AMP’ers virkningsmekanismer, der i de seneste år har ført dem ind i et forskningsmæssigt ”spotlight”. Disse små molekyler er en vigtig del af vores immunforsvar og har derved haft til opgave at bekæmpe bakterier i flere årtusinder! Der er på det seneste opstået en interesse for at undersøge, om AMP’er kan benyttes som lægemidler.

    Men hvad gør AMP’er egentlig?

    AMP’er er specielle, da de i modsætning til traditionelle antibiotika har flere forskellige virkningsmekanismer. AMP’er har nemlig mange forskellige ’targets’ på bakterier, som gør det svært for mikroorganismerne at blive resistente over for peptiderne. Hvis der forekommer en mutation i ét af AMP’ernes ’targets’, vil der stadig være processer, som AMP’er kan gå ind og ødelægge. Alle AMP’er har evnen til at binde sig til bakterielle cellemembraner og interagere med dem. De fleste AMP’ers primære virkningsmekanisme ligger i deres evne til at lave huller i cellemembraner, hvorved den gøres permeabel (gennemtrængelig) for forskellige molekyler, og der sker derfor et tab af livsvigtige ioner og andre cellulære komponenter (se figur 4). Dette resulterer i øjeblikkelig celledød. De fleste eksperimentelle studier med AMP’er fokuserer på deres membranødelæggende egenskaber, men nogle AMP’er har vist sig at kunne trænge gennem cellemembranen og ind i cellen, hvorved de også kan udøve en effekt på intracellulære områder. Disse AMP’er kan gå ind og påvirke dannelsen af cellevæggen, eller de kan påvirke DNA-syntesen. AMP’ers membranødelæggende effekt og brede spektrum af virkningsmekanismer gør det svært for bakterier at udvikle resistens over for dem. De fleste AMP’er har ligesom antibiotika kun en effekt på bakterieceller. Forskelle i prokaryote og eukaryote cellers overflade og deres biologiske cellemembran gør, at AMP’er kan skelne mellem de to typer af celler. Bakteriers cellemembran har en negativ ladning, mens den humane cellemembran oftest er neutral. Derudover er bakterier beskyttet af en ekstern cellevæg, der ligesom den bakterielle cellemembran er anionisk, dvs. negativt ladet. Tykkelsen af cellevæggen varierer fra bakteriecelle til bakteriecelle, hvilket resulterer i, at man kan inddele bakterier i de såkaldte Gram-positive og Gram-negative bakterier.

    Den negative overflade, som bakterieceller har, er grunden til, at AMP’er kun har en effekt på bakterier. AMP’er er nemlig kationiske, altså de har en overordnet positiv ladning, og derfor vil de tiltrækkes af bakteriens negativt ladede overflade, hvorefter de kan udøve deres effekt.

    Figur 4Figuren illustrerer den negativt ladede bakterielle membranoverflade, som AMP’er, på det første billede, binder sig til. AMP’erne tiltrækkes den bakterielle cellemembran på grund af deres positive ladning og kan efterfølgende bore sig ned i membranen, hvilket resulterer i øjeblikkelig celledød.


    Hvad er forklaringen bag virkningsmekanismen af antimikrobielle peptider?

    I de seneste 20 år er mere end 1000 naturlige AMP’er blevet identificeret i forskellige organismer. AMP’er er meget forskellige i deres opbygning, struktur og længde, men fælles for AMP’er er, at de er små proteiner opbygget af mellem 10 og 80 aminosyrer, samt at de er bakteriocidale. Ligesom alle andre proteiner produceres de inde i vores celler ud fra generne kodet i vores DNA (se artikel om transkription, translation og det centrale dogme her). Proteiner kan have mange forskellige destinationer i eller uden for cellen og for at guide dem hen til det rigtige sted, indeholder de fleste proteiner et signalpeptid. Signalpeptidet på AMP’er medfører, at de secerneres (udskilles) af cellen. Når de er blevet secerneret fra vores celler, kan de angribe patogene bakterier ved at binde sig til bakteriernes negativt ladede overflade. Det er sammensætningen af aminosyrer i AMP’er, der giver dem deres positive ladning. AMP’ers nettoladning varierer meget, idet den oftest ligger mellem 0 og +16, men de fleste aktive AMP’er har en ladning, der ligger nogenlunde midt i mellem disse to ydre værdier.

    Antimikrobielle peptider er ikke bare lige kæder af aminosyrer. De folder sig sammen og får en tredimensionel struktur, som har betydning for, hvordan de binder til bakterier. Den tredimensionelle foldning er karakteristisk for proteiner generelt, idet de på denne måde opnår deres endelige funktionelle struktur. AMP’er kan groft inddeles i følgende grupper på baggrund af deres sekundære proteinstruktur:

    1. α-helix AMP

    2. Cystein-stabiliserede β-sheet AMP

    3. AMP’er rige på specifikke aminosyrer

    AMP’er kan bestå af en enkel af ovenstående strukturer, men også indeholde flere af disse. Som eksempel på forskellige strukturer af AMP’er kan nævnes de to overordnede grupper af AMP’er, der findes i mennesker. Disse er defensiner og cathelicidiner. Defensiner er kationiske peptider, der tilhører gruppen af cystein-stabiliserede β-sheet AMP’er, hvilket vil sige, at peptiderne indeholder aminosyren cystein, som kan lave disulfidbroer, der stabiliserer AMP’er (se figur 5). Cathelicidiner er også positivt ladede, men indeholder ingen disulfidbroer, og strukturen udgøres af en α-helix. Selvom der er forskel på den tredimensionelle struktur af AMP’er, har de det fællestræk, at de er amphipatiske. Dette betyder, at de polære aminosyrer er adskilt fra de upolære aminosyrer i kæden, og overordnet set vil AMP’er derfor bestå af en hydrofob og en hydrofil del. Omtrent 50 % af aminosyrerne er hydrofobe hos de fleste antimikrobielle peptider, og den hydrofobe del, samt adskillelsen af denne fra den hydrofile del af AMP’et, er essentiel for AMP’ers antimikrobielle effekt.

    Figur 5To cysteinenheder sammenkobles i en oxidationsreaktion, hvorved der dannes en disulfidbinding.

    AMP’ers umiddelbare binding til cellemembraner sker gennem interaktioner mellem den kationiske del af AMP og den negativt ladede bakterielle cellemembran. Efter umiddelbar tiltrækning og binding af AMP’er til cellemembranen ophobes de for at kunne udøve deres effekt. Når der kun er få AMP’er til stede befinder de sig parallelt med cellemembranens overflade, og det ser ud som AMP’erne ligger på cellemembranen. Efterhånden som der tiltrækkes flere peptider til cellens overflade, vil de begynde at bore sig ned i cellemembranen. Peptiderne binder sig sammen og danner en transmembran (membrangennemborende) kanal. På denne måde skaber peptiderne et hul i cellemembranen. AMP’erne sætter sig sammen således, at peptidernes hydrofobe side vender ud mod cellemembranens hydrofobe fedtsyrer, mens deres hydrofile side vender ind mod de andre peptiders hydrofile side. Når der er et hul i cellemembranen kan hydrofile (polære) stoffer og ioner, der ellers ikke ville kunne passere cellemembranen, nu bevæge sig frit frem og tilbage gennem hullet, hvorved cellen dør.

    Som det fremgår af ovenstående, er den hydrofobe del af AMP’er vigtig i ødelæggelsen af bakterielle cellemembraner. Dog kan det være et problem, hvis der er for mange hydrofobe aminosyrer i dem, da specificiteten over for bakterielle cellemembraner mindskes. Dette skyldes, at de hydrofobe regioner på peptidet tiltrækkes af hydrofobe regioner på eukaryote cellemembraner. Herved kan man risikere, at cellemembranerne hos de eukaryote celler vil blive ødelagt sammen med eller i stedet for de prokaryote cellemembraner hos bakterierne. Hvis de antimikrobielle peptider har denne effekt på humane celler, siges de at være toksiske over for mennesker. De fleste AMP’er i naturen er ikke hydrofobe nok til at udvise denne toksicitet over for mennesker og udviser kun eller næsten kun toksicitet over for bakterier.

    Hvordan kan vi bruge antimikrobielle peptider som lægemidler? Det er vigtigt at forstå de molekylære mekanismer bag AMP’ers antibakterielle effekt for at kunne designe syntetiske AMP’er og derved bruge dem som lægemidler. Selvom der stadig er uklarhed omkring AMP’ers præcise virkningsmekanismer, hersker der ingen tvivl om, at en del af AMP’ers antibakterielle effekt ligger i deres interaktion med cellemembraner. Derudover har mange AMP’er vist sig at virke hæmmende på cellevægssyntese og celledeling, idet nogle AMP’er kan bevæge sig ind i cellen og påvirke intracellulære processer. Et eksempel på en AMP, der virker hæmmende på cellevægssyntesen er Plectasin.

    Den stigende forekomst af resistente bakterier er hovedårsagen til vores interesse for AMP’er. Mange forsøg med AMP’er tyder på, at de kan være fordelagtige at anvende som antimikrobielle lægemidler i stedet for konventionelle antibiotika. Da AMP’er er specifikke over for en så fundamental del af cellen som dennes membran, er sandsynligheden for, at der udvikles resistens, minimal. Det ville kræve meget af bakterien, hvis den skulle til at ændre sin cellemembran og udvikle en resistensmekanisme til at bekæmpe AMP’ers membranødelæggende effekt. Derudover gør AMP’ers mange virkningsmekanismer det svært for mikroorganismer at blive resistente over for dem. Grunden til dette er, at hvis der forekommer en mutation i ét af AMP’ernes ’targets’, vil der stadig være andre processer, som AMP’er kan gå ind og ødelægge, hvilket forhindrer bakterien i at vokse. Idet de fleste AMP’ers primære virkningsmekanisme er gennemhulning af cellemembranen, siger man, at AMP’er er bakteriocidale frem for bakteriostatiske. På grund af deres amphipatiske natur binder de sig desuden effektivt til den bakterielle cellemembran, som hos både Gram-positive og Gram-negative bakterier er negativt ladet. Dog skal det nævnes, at forskellige AMP’er kan have meget forskellig aktivitet over for de to typer af bakterier. Nogle AMP’er udviser kun en effekt på Gram-positive bakterier, nogle udviser kun en effekt på Gram-negative bakterier og andre har en effekt på både Gram-positive bakterier og Gram-negative bakterier. I mange af de forsøg, der er blevet lavet med diverse AMP’er, viser det sig, at der ikke skal tilsættes særlig meget af peptidet for at dræbe bakterierne. Man siger, at AMP’er har en lav ”Minimal Bacteriocidal Concentration” (MBC).

    Det tyder på, at AMP’er er de perfekte lægemidler, men hvorfor er de så ikke på markedet endnu? Processen, man skal igennem fra opdagelsen af et stof, der har potentiale til at blive et godt lægemiddel, til produktionen og indførelsen af dette på markedet, er mildt sagt lang og sej. Et potentielt lægemiddel skal igennem en lang række forsøg i laboratoriet før det må testes på mennesker i kliniske studierLægemiddeludviklingsprocessen er tidskrævende og dyr, og det tager i gennemsnit 14 år og koster 3 milliarder kroner at få et lægemiddel på markedet. Der forekommer mange forhindringer på vejen mod design af AMP’er som lægemidler, men den stigende forekomst af resistente bakterier skal bekæmpes på en eller anden måde. Flere AMP’er har også vist sig at være meget lovende, hvilket bl.a. fremgår af Historien om mirakelmedicin fra en lille sort svamp. Denne historie fortæller om det lille vidunderstof Plectasin, som blev fundet ved en tilfældighed.

    Hvordan opdager man lægemidler ved en tilfældighed? Hele vores antibiotikahistorie startede med en tilfældig opdagelse, nemlig opdagelsen af penicillin. Det har siden hen ikke været en sjældenhed, at potentielle lægemidler er blevet opdaget ved en tilfældighed. I 2002 undersøgte en forsker fra Novozymes den lille sorte svamp Pseudoplectania Nigrella, idet han var på udkig efter enzymer med signalsekvenser, der transporterer enzymerne ud af cellen. Han benyttede sig af computerbaserede metoder til at undersøge gensekvenserne, han fandt fra svampen, og faldt pludselig over en lille DNA-sekvens, der i høj grad mindede om humane defensiner. Kunne dette være et AMP? Ja, det viste sig netop at være tilfældet. Det var ikke alene et AMP, det var tilmed et effektivt ét af slagsen. Forskeren lavede senere en undersøgelse af en sandorm, idet målet endnu engang var at finde enzymer, der nu skulle kunne bruges i vaskemiddel. Her blev det lille cystein-stabiliserede β-sheet AMP Arenicin 3 fundet, som viste sig at have en utrolig effekt på Gram-negative bakterier. Arenicin 3 har fået sit navn, fordi der tidligere er blevet fundet to AMP’er, Arenicin 1 og Arenicin 2, som det strukturelt set ligner meget. Disse to AMP’er havde vist sig at have en effekt på både Gram-positive og Gram-negative bakterier.

    Er antimikrobielle peptider så fremtidens antibiotika? Dette spørgsmål kan du måske være med til at svare på? Forskningen inden for AMP’er er stadig en åben bog, og vi kan ikke gøre andet end at læse videre. Man vil selvfølgelig gerne sætte en stopper for den stigende fremkomst af resistente bakterier, men er det muligt at designe og producere tilstrækkelige antibiotika til at stoppe fremkomsten? Hvis resistensudvikling skal begrænses, kræver det, at man er restriktiv med brugen af antibiotika. Lægerne må kun udskrive recepter på antibiotika, når de er sikre på, at der er tale om en bakterieinfektion, og det er vigtigt, at man som patient nøje følger lægens vejledning og ikke stopper antibiotikabehandlingen for tidligt.

  • Teori

    Baggrundsartikler

    Teorimaterialet består af seks artikler, som har til formål at danne grundlag for forståelsen af artiklen Antimikrobielle peptider: Historie, fremkomst og fremtid. Artiklerne kan læses uafhængigt af hinanden samt i forbindelse med gennemgangen af hovedartiklen om antimikrobielle peptider.

    Du kan gå til artiklerne ved at bruge menuen i venstre side. En oversigt over artiklerne, der ved gennemgang giver en dybere forståelse for antimikrobielle peptider og teorien bag dem, ses nedenfor:

    • Prokaryoter, eukaryoter og den biologiske cellemembran
    • Inddeling af bakterier i Gram positive og Gram negative
    • Lægemiddeludvikling og antimikrobielle peptider
    • Proteinstruktur og de 20 aminosyrer
    • Resistens og mutationer
    • Signalpeptider og propeptider

    God fornøjelse!

    Der er mange forskelle mellem den bakterielle og humane celle og celleoverflade. Disse forskelle har betydning for, hvordan antimikrobielle peptider (AMP’er) tiltrækkes cellen, og deres evne til dernæst at lave huller i cellemembranen. Bakterieceller tilhører gruppen af prokaryote celler, dvs. celler uden en cellekerne, hvorimod humane celler er eukaryoteceller, der har en cellekerne. For at få en forståelse for hvorfor de fleste AMP’er i højere grad tiltrækkes bakterielle celler end menneskets celler, ser denne artikel nærmere på den biologiske cellemembran og forskellen på prokaryoters og eukaryoters overflade.

    Biologiske cellemembraner består af lipider (fedtstoffer). Lipider i membraner indeholder både en hydrofob og en hydrofildel. Man siger, at lipiderne består af et hydrofilt ”hoved” og en hydrofob ”hale” (Figur 1). Når lipiderne går sammen og danner en membran, vil deres hydrofobe ”haler” interagere med hinanden, hvorved membranen får et hydrofobt indre, mens de hydrofile ”hoveder” vender ud mod de vandige miljøer, som findes uden for cellen og inden i cellen. På grund af tilstedeværelsen af både hydrofobe og hydrofile regioner er membranlipiderne amfipatiske molekyler.

    Figur 1. Den biologiske cellemembran består hovedsageligt af fosfolipider, der befinder sig i en dobbeltlagsstruktur.

    I forhold til AMP’er er det den hydrofile del af cellemembranen, der er interessant at se nærmere på. Dette skyldes, at det er den hydrofile del af lipiderne, der vender ud mod omgivelserne, og det er derved denne del af cellemembranen, som AMP’er skal vekselvirke med. Den hydrofile del er afgørende for, om AMP’er virker på bakterier eller mennesker.

    Den mest grundlæggende egenskab af lipiderne, der findes i cellemembranen, er, at de er amfipatiske. Den hydrofobe del kan have varierende længde og bestå af et varierende antal dobbeltbindinger. Den hydrofile del indeholder ladede grupper, f.eks. fosfat (PO4-), som er negativt ladet, eller ammoniak (NH3+), som er positivt ladet. Cellemembraner vil have forskellige overordnede ladninger alt afhængigt af antallet af positivt og negativt ladede grupper. Hvis der eksempelvis kun er en negativ fosfatgruppe i de lipider, der opbygger en given membran, vil membranen være negativ. Hvis der derimod både er en fosfatgruppe (-1 i ladning) og en ammoniakgruppe (+1 i ladning) i lipiderne, vil membranen være neutralt ladet. Lipider, der både indeholder en positivt ladet gruppe og en negativt ladet gruppe, men har en samlet ladning på 0 (neutrale lipider), kaldes zwitterioniske lipider.

    Den mest udbredte gruppe af membranlipider indeholder en fosfation i det hydrofile hoved enten alene eller sammen med en anden ion. Denne gruppe af lipider kaldes fosfolipider. Fosfolipiderne ses i en dobbeltlagsstruktur i figur 1 og deres generelle struktur, samt eksempler på forskellige slags fosfolipider, er vist i figur 2.

    Diversiteten i lipidernes opbygning er afgørende for, om AMP’er virker på en given organisme. De lipider, der findes i den prokaryote membran, er primært negativt ladede, mens de der findes i den eukaryote membran ofte er neutralt ladet (Figur 2). Det skal understreges, at der hos begge celletyper findes et væld af andre lipider, men de i figur 2 nævnte udgør størstedelen af membranernes lipidindhold og er derfor bestemmende for membranens ladning.

    Udover cellemembranen har bakterieceller en cellevæg, der ikke ses hos humane celler. Bakteriers cellevæg består af molekylet peptidoglycan (figur 3). Cellevæggen hos Gram-positive mikroorganismer består af et relativt tykt lag peptidopglycan, hvori der sidder teichoidsyrer, som er negativt ladede. Hos Gram-negative bakterier er cellevæggen noget tyndere, men uden på denne sidder en ekstra membran; den ydre cellemembran. I den ydre cellemembran findes lipopolysaccharid (LPS), der også har en negativ ladning. Heraf ses, at cellevæggen hos både Gram-positive og Gram-negative bakterier repræsenterer en negativ overflade.

    Da AMP’er er kationiske, vil de tiltrækkes celleoverflader, der er negativt ladet. AMP’er vil derfor foretrække at binde til en negativt ladet bakterieoverflade frem for en human celleoverflade.

    Når kationiske AMP’er nærmer sig cellens overflade og kommer i kontakt med den cytoplasmiske cellemembran, vil de interagere med de negativt ladede “hoveder” på fosfolipiderne. For at AMP’erne kan bore sig ned i cellemembranen og sætte sig dér, skal AMP’erne have en amfipatisk struktur, hvorved den hydrofile del kan interagere med fosfolipidernes ”hoveder” og de andre AMP’ers hydrofile del, mens den hydrofobe del interagerer med fosfolipidernes ”haler” i den indre del af cellemembranen (se figur 4). På grund af AMP’ers struktur og indhold af hydrofobe aminosyrer kan de indsætte sig i både eukaryote og prokaryote cellemembraner, men idet eukaryote membraner primært består af zwitterioniske lipider med en nettoladning på 0, og prokaryote membraner består af negativt ladede lipider, vil AMP’er tiltrækkes bakterielle cellemembraner i højere grad end humane cellemembraner.

     Figur 2Strukturen af forskellige fosfolipider

    Figur 3Her vises strukturen af peptidoglycan. Peptidoglycanenheder er bundet sammen på kryds og tværs og danner en ensartet struktur omkring bakteriens plasmamembran.

     Figur 5. Her ses den generelle struktur af en aminosyre. Sidekæden ’R’ varierer fra aminosyre til aminosyre, og det er derfor denne gruppe, der giver aminosyren sine specifikke karakteristika.

    Figur 4Figuren illustrerer den negativt ladede bakterielle membranoverflade, som AMP’er, på det første billede, binder sig til. AMP’erne tiltrækkes den bakterielle cellemembran på grund af deres positive ladning og kan efterfølgende bore sig ned i membranen og sætte sig dér, hvilket ses på det tredje billede.

    Den hydrofobe del af AMP’er er vigtig for at kunne ødelægge bakterielle cellemembraner, og forsøg har vist, at en betydelig andel af aminosyrerne i peptidkæden (over 30 %) skal være hydrofobiske for at have en effekt. På den anden side kan det være et problem, hvis AMP’er består af for mange hydrofobe aminosyrer, da specificiteten over for bakterielle cellemembraner mindskes. Dette skyldes, at de hydrofobe regioner på peptidet tiltrækkes af hydrofobe regioner på eukaryote cellemembraner. Herved kan man risikere, at cellemembranerne hos de eukaryote celler vil blive ødelagt sammen med eller i stedet for de prokaryote cellemembraner hos bakterierne. Hvis AMP’er har denne effekt på humane celler, siges de at være toksiske over for mennesker. Procentdelen af hydrofobiske aminosyrer i naturligt forekomne AMP’er varierer, men ligger på omkring 40-60 %. De fleste AMP’er i naturen er derved ikke hydrofobe nok til at udvise toksicitet over for mennesker og udviser kun eller næsten kun toksicitet over for bakterier. Toksiciteten af AMP’er over for mennesker måles i form af deres hæmolytiske effekt, dvs. i hvor høj grad de ødelægger røde blodlegemer.

    Figur 6. Toksiciteten af AMP’er over for mennesker måles i form af den hæmolytiske effekt, dvs. i hvor høj grad AMP’erne ødelægger røde blodlegemer. Den hæmolytiske proces ses på figuren.

    Når vi vil benytte AMP’er som lægemidler, er det essentielt, at de udviser selektivitet over for bakterieceller. Med andre ord er det vigtigt, at de hellere vil angribe og dræbe bakterieceller end kroppens egne celler. Denne selektivitet afhænger af flere faktorer. Det er vigtigt, at der er den rette balance mellem hydrofobe og ladede aminosyrer i peptidkæden. Hvis peptiderne er for polære, er der en mindre tiltrækningskraft mellem peptiderne og den bakterielle cellemembran. Hvis peptiderne er for hydrofobe, er de ikke i stand til at skelne ordentligt mellem bakterieceller og humane celler. Når AMP’er består af mange hydrofobe aminosyrer, vil de højst sandsynligt også have en mindre positiv ladning, hvorved chancen for, at de tiltrækkes bakteriemembraner frem for humane cellemembraner, mindskes. De fleste AMP’er udøver deres antibakterielle effekt ved at lave huller i cellemembranen. For at dette er muligt, skal de kunne gennemkrydse hele cellemembranen, hvorved længden af det antimikrobielle peptid skal være omtrent den samme som cellemembranens tykkelse. AMP’ers længde er derved også en vigtig faktor at tage i betragtning. For at gøre membranen gennemtrængelig skal AMP’er strække sig over hele membranen, og de skal have en vis længde for, at dette kan lade sig gøre. Det er derfor et problem, hvis AMP’er er for korte. Forsøg har vist, at AMP’er, der består af færre end 12 aminosyrer, er næsten helt inaktive. Udover AMP’ernes længde, er den antibakterielle effekt oftest større for AMP’er, der har en amfipatisk struktur, når de kommer i kontakt med cellemembranen. Den amfipatiske struktur gør det muligt for peptiderne at bore sig ned i membranen og lave huller i den.

    Den bakteriedræbende effekt af AMP’er er hovedsageligt bestemt af deres ladning, længde, hydrofobicitet, amfipacitet og sekundære struktur. Optimering af disse variable kan øge interaktionen mellem AMP’er og den bakterielle plasmamembran. Det er denne optimering, der lægges fokus på, når der skal designes lægemidler på baggrund af naturligt forekomne AMP’er.

    Bakterier kan inddeles i to kategorier alt efter deres cellevægsstruktur. Tykkelsen af cellevæggen varierer fra bakteriecelle til bakteriecelle, hvilket resulterer i, at man kan inddele bakterier i de såkaldte Gram-positive og Gram-negative bakterier. Fælles for Gram-positive og Gram-negative bakterier er, at de har en anionisk, det vil sige negativt ladet, overflade, der tiltrækker kationiske, altså positivt ladede, antimikrobielle peptider (AMP’er). Det er hovedsageligt bakteriernes cellevæg, der giver dem en anionisk overflade, men også deres cellemembran er negativt ladet. Den negativt ladede overflade hos bakterielle celler ses ikke hos humane eukaryote celler, der typisk har en neutral overflade. Det er derfor hovedsageligt bakterieceller med deres anioniske overflade, der tiltrækker AMP’er.

    Figur 1Den biologiske cellemembran består hovedsageligt af fosfolipider, der befinder sig i en dobbeltlagsstruktur.

    På grund af bakteriernes negativt ladet cellevæg og AMP’ernes positive ladning, virker bakterier som magneter på AMP’er. Selvom de to typer bakterier begge tiltrækker AMP’er, medfører den strukturelle forskel på Gram-positive og Gram-negative bakteriers cellevæg, at antimikrobielle peptider interagerer på forskellige måder med de to typer af bakterier.

    Plasmamembranen indeslutter cellens cytoplasma og arvemateriale i form af DNA, og membranens vigtigste funktion er at forsyne cellen med en selektiv barriere, hvorigennem stoffer kan bevæge sig. Da kun visse molekyler og ioner kan bevæge sig gennem membranen, siges den at være semipermeabel, dvs. den er delvist gennemtrængelig. Store molekyler, som f.eks. proteiner, kan ikke bevæge sig gennem cellemembranen, mens små molekyler, så som vand, nemmere kan komme igennem membranen.

    Visse antibiotika og AMP’er er i stand til at ødelægge den beskyttende cellevæg omkring cellemembranen, hvilket fører til at bakteriecellen lyserer, dvs. sprænges. Denne lysis af cellen finder sted, fordi bakterielt cytoplasma har en høj koncentration af opløste stoffer i forhold til den lavere stofkoncentration uden for cellen. Når cellevæggen svækkes eller ødelægges helt, vil vand sive ind i cellen for at udligne forskellen i stofkoncentration inden i og uden for cellen, en proces der kaldes osmose. Cellen svulmer herved op og eksploderer.

    Figur 2Vand vil sive ind i en bakteriecelle, hvis dennes cellevæg er blevet svækket eller ødelagt, hvorved bakteriecellen vil lysere, dvs. sprænges.

    Cellevæggen er derfor uundværlig for bakterier. Den består af peptidoglycanenheder (illustreret på figur 3) bundet sammen på kryds og tværs, som danner en ensartet struktur omkring bakteriens plasmamembran. Cellevæggen repræsenterer altså en kompleks makromolekylær struktur, som har det formål at give mikroorganismerne en stivhed og forhindre osmotisk cellelysis.

    Tykkelsen af cellevæggen varierer fra bakteriecelle til bakteriecelle, hvilket resulterer i, at man kan inddele bakterier i de såkaldte Gram-positive og Gram-negative bakterier. Cellevæggen hos Gram-positive bakterier består af et relativt tykt lag peptidoglycan (20-40 nm), mens peptidoglycanlaget hos Gram-negative bakterier er væsentligt tyndere (2-7 nm). Denne opdeling af bakterier i Gram-negative og Gram-positive stammer fra Gramfarvningen udviklet af den danske læge Hans Christian Joachim Gram i 1884. Gramfarvningen inddeler bakterierne i de to grupper alt efter, hvordan de lader sig farve med det violette farvestof methylviolet. De Gram-positive bakterier har en tyk cellevæg, der absorberer farven og vil derfor fremtræde violette under mikroskop, mens de Gram-negative bakterier, med deres tynde cellevæg, farves røde eller lyserøde (se figur 4).

     Figur 3Cellevæggens peptidoglycanlag består af en masse peptidoglycan monomerer sat sammen til en polymer, som danner en ensartet struktur omkring bakteriens plasmamembran.

    Tykkelsen af peptidoglycanlaget hos Gram-positive og Gram-negative bakterier er ikke det eneste karakteristikum, der adskiller de to typer af bakterier fra hinanden (se figur 5). Den anioniske bakterieoverflade, der tiltrækker kationiske AMP’er, skyldes tilstedeværelsen af forskellige molekyler på overfladen af Gram-positive og Gram-negative bakterier. Den umiddelbare tiltrækning af antimikrobielle peptider til Gram-positive bakterier skyldes de negativt ladede teichoidsyrer, som er bundet til Gram-positive bakteriers cellevæg. Teichoidsyrer består primært af alkohol (glycerol eller ribitol) og phosphat. Der er to slags techoidsyrer. Den ene kaldes lipotechoidsyre, som strækker sig over hele peptidoglycanlaget (cellevæggen) og er bundet til bakteriens plasmamembran. Den anden er teichoidsyre, og denne er udelukkende bundet til peptidoglycanlaget. Idet teichoidsyrerne, pga. phoshatgrupperne, er negativt ladede, kan de binde kationer (positive ioner), og derved også positivt ladede AMP’er.

    Figur 4Gram-negative bakterier fremstår lyserøde i et mikroskop, mens Gram-positive bakterier fremstår violette.

    Når AMP’er binder sig til Gram-positive bakterier akkumuleres de først på cellevæggen og optages herefter ret langsomt i forhold til, hvor hurtigt de optages i Gram-negative bakterier. Grunden til at optag af AMP’er i Gram-positive bakterier kan tage længere tid end i de Gram-negative er, at Gram-positive bakterier har et tykt peptidoglycanlag, som det tager tid at komme igennem.

    Det tynde peptidoglycanlag hos Gram-negative bakterier indeholder, i modsætning til hos de Gram-positive bakterier, ikke negativt ladede teichoidsyrer, hvorved den umiddelbare tiltrækning af AMP’er til Gram-negative bakterier foregår på en anden måde end hos Gram-positive. Udover peptidoglycanlaget har Gram-negative bakterier en ydre cellemembran, der ikke ses hos Gram-positive bakterier. Mellem peptidoglycanlaget og hhv. plasmamembranen (den indre membran) og den ydre membran, findes det periplasmiske rum. Det periplasmiske rum er fyldt med periplasma, som er en geléagtig væske, der har en høj koncentration af nedbrydende enzymer og transportproteiner.

    Den ydre membran, som kun ses hos Gram-negative bakterier, har en overordnet negativ ladning, som bl.a. skyldes tilstedeværelsen af såkaldte lipopolysaccharider (LPS). Disse er store molekyler, der består af lipider (fedtstoffer) og polysaccharider (kulhydrater) bundet sammen. Dertil er der bundet negativt ladede phosphatgrupper (se figur 6).

    Figur 5Den Gram-positive bakteries cellevæg består af et tykt lag peptidoglycan, mens den Gram-negative bakteries cellevæg består af et tyndt lag og en ydre cellemembran.

    Mens det hos de Gram-positive bakterier er teichoidsyrer bundet til cellevæggen, der tiltrækker AMP’er, er det hos de Gram-negative bakterier tilstedeværelsen af LPS, der medfører, at AMP’er nemt tiltrækkes bakterien. Efter den umiddelbare tiltrækning af kationiske AMP’er til det anioniske LPS i Gram-negative bakteriers ydre membran, bliver dette område af membranen destabiliseret, og der dannes små sprækker, hvilket tillader passage af små hydrofobe stoffer og peptider, heriblandt AMP’er. Denne mekanisme, som AMP’er benytter sig af, når de skal krydse de Gram-negative bakteriers ydre cellemembran, medfører et hurtigt optag af AMP’er, så de når ind til den indre membran, hvor de kan udøve deres effekt. Nogle AMP’er er ikke i stand til at benytte denne mekanisme og kan ikke krydse de Gram-negative bakteriers ydre cellemembran, hvorved de kun udøver en effekt på Gram-positive bakterier.

    Figur 6Lipopolysaccharid (LPS) molekylet.

     Tabel 1. Forskelle mellem Gram-Positive og Gram-Negative Bakterier.

    Grundet den stigende forekomst af resistente bakterier, er der i de seneste år kommet fokus på, hvorvidt antimikrobielle peptider (AMP’er) kan benyttes som nye antibiotika. Meget tid og mange penge er dog krævet for at få et nyt antibiotikum på markedet. Lægemidler skal godkendes, før de må sælges. I Danmark skal medicinalvirksomheden ansøge enten Sundhedsstyrelsen eller EU om godkendelse af lægemidlet, før det må sendes på markedet. Der stilles mange strenge krav, som et potentielt antibiotisk stof skal kunne opfylde. Udviklingen af nye antibiotika og andre lægemidler er derved en lang og sej proces (Figur 1).

    Hvis et lægemiddel med succes kommer igennem de prækliniske studier, skal det efterfølgende igennem flere forskellige kliniske studier med mennesker, før det kan godkendes som værende tilfredsstillende nok til at komme på markedet. Statistisk set vil der, ud af de 10.000 molekyler, der viser sig at have potentiale i lægemiddeldesignfasen (Figur 1), være ca. 500, der er sikre nok til at fortsætte til prækliniske studier, hvor de testes på dyr. Heraf vil omkring 10 molekyler nå de første kliniske studier udført med mennesker og kun 1 ud af de oprindelige 10.000 molekyler vil i sidste ende komme på markedet, som et godkendt lægemiddel. Det tager i gennemsnit 14 år og 3 milliarder kroner at få et lægemiddel på markedet.

    Undervejs i processen vil der uden tvivl opstå problemer, idet lægemidlet skal opfylde utallige krav, før det kan sendes ud på markedet. Lægemidlet skal have den ønskede effekt og kun virke et specifikt sted i kroppen uden at forsage problemer andre steder.

    Figur 1Figuren viser lægemiddeludviklingsprocessen fra opdagelsen af lovende molekyler til de sidste stadier i de kliniske studier med mennesker.

    Hvis lægemidlet ikke udelukkende virker det ønskede sted, kan det være toksisk (giftigt) for kroppen, hvorved der kan forekomme bivirkninger ved indtag af stoffet. Ved udvikling af et nyt lægemiddel fokuseres der derfor først og fremmest på interaktionerne mellem lægemidlet og det område i kroppen, hvor lægemidlet skal udøve sin effekt, samt om lægemidlet i det hele taget når frem til det ønskede område. Dette specifikke område, hvortil lægemidlet skal nå hen og binde sig kaldes et ’target’.

    Under udviklingen af lægemidler vælges først hvilken sygdom, der ønskes bekæmpet, og derved hvilket ’target’, som lægemidlet skal angribe. Det er dernæst vigtigt at finde et stof, der kan binde sig til det ønskede target og udøve sin effekt uden at have bivirkninger. ’Target’ for AMP’er er, ligesom for traditionelle antibiotika, bakteriecellen. Det varierer dog meget, hvordan forskellige AMP’er udøver deres effekt på bakterien. AMP’er tiltrækkes bakteriecellen grundet ladningsforskelle, idet AMP’er er kationiske, mens bakteriecellens overflade er anionisk, hvorefter de fleste AMP’er borer sig ned cellemembranen og laver huller. Cellemembranen bliver derved permeabel (gennemtrængelig) for livsvigtige molekyler, der siver ud, hvilket resulterer i øjeblikkelig celledød.

    Når vi har udvalgt et kemisk stof, som vi er interesseret i at teste, kan vi begynde at udføre forskellige forsøg. Før vi kan teste et potentielt lægemiddel på mennesker, skal det igennem en række prækliniske studier. Først udføres in vitro studier med det potentielle lægemiddel for at undersøge, om det virker på det ønskede ’target’. Dernæst benyttes in vivoeksperimenter til at undersøge, om stoffet kan nå det ønskede ’target’ uden at blive nedbrudt undervejs. Hvis lægemidlet skal kunne indtages oralt, skal det igennem flere forhindringer på sin vej til sit mål. Det skal kunne modstå nedbrydning af diverse enzymer i tarmen, kunne absorberes henover tarmvæggen, komme igennem leveren uden at blive nedbrudt for meget og transporteres i blodbanen uden at blive nedbrudt for hurtigt (Figur 2).

    Et AMP, der tænkes at være et potentielt lægemiddel, skal igennem diverse eksperimenter, før det kan godkendes til at blive testet i kliniske studier.

    Figur 2. Når et lægemiddel indtages oralt, skal det igennem flere forhindringer på sin vej til at nå sit ’target’.

    AMP’et skal testes på specifikke bakteriekulturer for at undersøge om det har en effekt på Gram-positive bakterier, Gram-negative bakterier eller begge. AMP’et skal være stabilt under fysiologiske betingelser og undgå at blive nedbrudt for hurtigt. Det skal testes, om AMP’et forbliver aktivt, når det kommer ind i blodbanen, dvs. om det er salttolerant. Det skal være proteasestabilt, hvilket betyder, at det ikke må nedbrydes af proteaser i kroppen. Proteaser er enzymer, der nedbryder proteiner. Derudover må dets effekt ikke hæmmes af kationer (positivt ladede ioner).

    Figur 2. Når et lægemiddel indtages oralt, skal det igennem flere forhindringer på sin vej til at nå sit ’target’.

    Effektiviteten af det potentielle antibiotikum testes ved at undersøge, hvor stor en antibiotikakoncentration der skal til for at dræbe de tilstedeværende bakterier. Denne dosis antibiotikum kaldes den effektive dosis. Det skal også testes, hvor stor en koncentration der skal til for at dræbe røde blodlegemer, hvilket kaldes den toksiske dosis. Forholdet mellem den toksiske dosis og den effektive dosis betegnes det terapeutiske indeks.

    Ideelt set, skal der være stor forskel på den effektive dosis og den toksiske dosis, idet der helst kun skal en lille mængde antibiotikum til for at have en helbredende effekt, mens en meget større dosis kræves for at have en toksisk effekt på kroppen. Når det terapeutiske indeks er blevet bestemt, skal der udføres forsøg, det tester, hvor længe AMP’et bliver i kroppen, dvs. hvor lang tid der går, før det er blevet nedbrudt. AMP’et skal blive længe nok i kroppen til at udøve sin effekt, men ikke så længe, at det har en toksisk effekt på kroppen. Da AMP’ers primære virkningsmekanisme er at lave huller i cellemembranen, kan det bestemmes i hvilken grad, det testede AMP laver disse huller og ødelægger cellemembranen. Dette kan måles ud fra hvor meget intracellulært indhold, der frigives fra bakterien til det ekstracellulære miljø. Udover de forskellige forsøg der skal udføres, skal der også tages højde for, hvad det koster at producere det potentielle lægemiddel i store mængder. En ulempe ved AMP’er er, at de generelt er dyre og teknisk svære at fremstille.

    AMP’er har oftest en virkelig god bakteriedræbende effekt, men mange peptider er toksiske, idet de angriber humane celler såvel som bakterieceller, eller de forbliver ikke længe i kroppen, da de nedbrydes af proteaser. Mange AMP’er, som umiddelbart virker som lovende lægemidler, når derved ikke til de kliniske studier.

    Lægemidlet vil nå til de kliniske studier, hvis stoffet har vist sig at have den ønskede effekt under dyreforsøg, viser sig at være bedre end andre lignende stoffer på markedet, kan klare ”rejsen” gennem kroppen uden at live nedbrudt undervejs, har få stofskifteprodukter, har en rimelig halveringstid og ingen alvorlige bivirkninger. De kliniske studier tager 5-7 år at udføre, involverer flere tusinde patienter og kan være meget dyre. De kliniske studier er opdelt i flere faser. Fase I studier forløber over ca. et år og involverer kun raske mennesker. Disse studier undersøger, hvordan stoffet metaboliseres i mennesker, og hvor biotilgængeligt det er. Fase II studier varer omkring to år og udføres med patienter, som har sygdommen, der ønskes kureret, mens fase III studier tager omkring 3 år og udføres med store grupper af patienter. På denne måde vil bivirkninger, der måske ikke er blevet bemærket i studier med mindre grupper af mennesker, evt. observeres i fase III studierne. Stoffer der testes, sammenlignes i høj grad med lægemidler, der allerede er på markedet. Dette gøres for at sikre, at man har at gøre med et stof, der adskiller sig tilstrækkeligt fra andre lægemidler på markedet.

    Antallet af AMP’er, der kommer igennem de prækliniske studier med succes, er begrænset. Dette skyldes, at mange naturligt forekomne AMP’er enten helt eller delvist mister deres antibakterielle effekt under fysiologiske betingelser, dvs. i et miljø, der ligner det i menneskekroppen. Et antimikrobielt peptid kan virke meget lovende, når det testes på bakterier alene, men hvis det viser sig at miste sin antibakterielle effekt, så snart det kommer ind i kroppen, vil det øjeblikkeligt blive afvist som potentielt lægemiddel. AMP’er er generelt meget pH- og saltfølsomme. De mister derved deres aktivitet, når saltkoncentrationen bliver for høj, og mange AMP’er mister deres aktivitet, når de kommer ind i blodet. Da AMP’er er små proteiner, kan de desuden risikere at blive nedbrudt af proteaser, hvorved de ikke forbliver i kroppen længe nok til at udøve deres effekt. Derudover binder nogle AMP’er sig til plasmaproteiner, som er proteiner, der befinder sig i blodet. Når AMP’erne er bundet til plasmaproteiner, vil de være forhindret i at binde sig til bakterielle cellemembraner. Flere naturligt forekomne AMP’er desuden er blevet associeret med toksicitet og udviser lav biotilgængelighed og lav metabolisk stabilitet, dvs. de nedbrydes hurtigt, når de kommer ind i kroppen. Toksiciteten af AMP’er kan dog mindskes ved at modificere dem syntetisk i laboratoriet. Når nye AMP’er skal designes, tages der udgangspunkt i naturlige AMP’er, hvis aktivitet er kendt. På denne måde kan man forbedre den antimikrobielle aktivitet og reducere toksiciteten ved at ændre en smule i aminosyresammensætningen.

    Aktuelt, bliver flere modificerede varianter af naturligt forekomne AMP’er testet i kliniske studier. De fleste af disse må dog bruges som cremer og påføres på selve infektionsstedet. Dette skyldes, at AMP’er, som nævnt, hurtigt bliver nedbrudt i kroppen, når de indtages oralt, idet de skal igennem mange forhindringer på vejen til deres ’target’. Da flere AMP’er nu er kvalificerede til fase II og fase III kliniske studier, kunne AMP’er godt tyde på at have potentiale til at være fremtidens antibiotika.

    Antimikrobielle peptider (AMP’er) er små proteiner, der er i stand til at dræbe mikroorganismer. AMP’er hører derved under proteiner, gruppen af de mest alsidige makromolekyler i vores krop, som har essentielle funktioner i de fleste biologiske processer. For at forstå hvordan antimikrobielle peptider ser ud, og hvordan de er struktureret, når de angriber en bakteriecelle, skal vi se nærmere på opbygningen af proteiner generelt.

    Proteiner er lineære polymerer bestående af enkelte monomerer kaldet aminosyrer, der er bundet sammen. Proteiner forbliver ikke lineære, men folder sig spontant sammen og danner en tredimensionel struktur, der er bestemt af den specifikke aminosyresekvens, dvs. sammensætning af de enkelte aminosyrer. Størrelsen af forskellige proteiner varierer meget, idet nogle kun er få aminosyrer lange, hvor bl.a. hormonet insulin, bestående af 51 aminosyrer, kan nævnes som eksempel, mens andre udgøres af flere tusinde aminosyrer, som eksempelvis muskelproteinet titin. Titin er det største protein man kender til, idet det består af over 27.000 aminosyrer.

    Aminosyrer er byggestenene i proteiner, og den specifikke aminosyresekvens i et protein betegnes dets primære struktur. En aminosyre består af et centralt carbonatom, som er bundet til en aminogruppe, NH2, en carboxylsyregruppe, COOH, et hydrogenatom og en speciel sidekæde, der kaldes R-gruppen (se figur 2).

    Der findes i alt 20 forskellige sidekæder, som varierer i størrelse, ladning, hydrofob karakter og kemisk reaktivitet. Alle proteiner i vores krop er opbygget af de samme 20 aminosyrer, og en oversigt over disse, kan du se her.

     Figur 1Proteinet insulin ses til venstre og sidestilles med muskelproteinet titin, som er det største protein, man kender til.

    I vandige opløsninger ved neutral pH-værdi er aminosyrer oftest zwitterioner, hvilket betyder at aminogruppen er protoneret (NH3+) og carboxylsyregruppen er deprotoneret (COO-). Hvorvidt aminosyrer er ioniseret eller ikke er ioniseret afhænger af pH-værdien (se figur 3).

    Proteiner dannes ved sammenkædning af aminosyrer. Aminosyrer sammenkædes via en kemisk reaktion mellem aminogruppen på én aminosyre og carboxylsyregruppen på en anden. Herved dannes en peptidbinding mellem de to aminosyrer. Reaktionen kaldes en kondensationsreaktion, da der fraspaltes vand (se figur 4). Flere aminosyrer, der er kædet sammen via peptidbindinger, danner en polypeptid kæde. De fleste polypeptid kæder består af mellem 50 og 2000 aminosyrer og betegnes proteiner. Kæder, der består af færre end 50 aminosyrer, betegnes peptider.

    Figur 2Fire kemiske grupper er bundet til det centrale carbon-atom. Sidekæden ’R’ varierer i de 20 forskellige aminosyrer, og det er derfor denne gruppe, der giver aminosyren sine specifikke karakteristika

    Figur 3Ved pH omkring 7 befinder aminosyrer sig hovedsageligt på en zwitterionisk form, hvor aminogruppen er protoneret og har derved en positiv ladning, mens carboxylgruppen er deprotoneret og har derved en negativ ladning.

    Antimikrobielle peptider er oftest under 50 aminosyrer lange, hvorfor de netop betegnes peptider. AMP’er er en gruppe molekyler, der strukturelt set er ret forskellige, da aminosyresekvensen varierer meget fra AMP til AMP. De karakteriseres dog ved at have en netto positiv ladning, dvs. de er kationiske, grundet tilstedeværelsen af positive aminosyrer. Derudover er en stor bestanddel (over 30 %) af aminosyrerne, der udgør peptiderne, hydrofobiske.

    Grundet den store variation i aminosyresekvensen, kan AMP’er ikke karakteriseres på baggrund af deres primærstruktur, men karakteriseres derved i stedet på baggrund af deres sekundærstruktur. AMP’er kan strukturelt set inddeles som værende:

     – α-helix AMP’er

     – cystein-stabiliserede β-sheet AMP’er

     – AMP’er rige på specifikke aminosyrer

    De cystein-stabiliserede β-sheet AMP’er indeholder en eller flere specielle krydsbindinger, der også ses i mange andre proteiner. Denne krydsbinding kaldes en disulfidbinding og er den mest almindeligt forekomne i proteiner. Denne dannes ved, at to cysteinenheder reagerer med hinanden og danner forbindelsen cystin (se figur 5). Disulfidbindingen er med til at stabilisere mange proteiner og er derfor et vigtigt strukturelement i nogle AMP’er.

    Figur 4To aminosyrer sammenkobles i en kondensationsreaktion ved fraspaltning af vand, hvorved der dannes en peptidbinding mellem dem

     Figur 5Aminosyren cystein er vigtig, da dens svovlatom medfører, at den har specifikke egenskaber. To cysteinenheder kan reagere og danne cystin, hvilket ses på figur 6.

    Figur 6To cysteinenheder sammenkobles i en oxidationsreaktion, hvorved der dannes en disulfidbinding.

    Proteiners sekundærstruktur er defineret som den lokale rumlige struktur af polypeptidkæden. Primærstrukturen, altså aminosyresekvensen, kan således resultere i mange områder med forskellige sekundærstrukturer. Sekundærstrukturen bestemmes af hydrogenbindinger mellem aminosyrerne i primærstrukturen. De to bedst definerede sekundærstrukturer er α-helixer og β-sheets. α-helixen er formet som en spiral, som aminosyrernes sidegrupper stikker ud fra (se figur 7). Spiralen drejer højre om, og der er 3,6 aminosyrer pr. omdrejning. Helixen holdes sammen af hydrogenbindinger mellem hver femte aminosyre. Strukturen kan stabiliseres yderligere af vekselvirkninger mellem sidegrupperne. Eksempeltvis kan hydrofobe vekselvirkninger, hvor sidegrupper, der er hydrofobe og derfor afskyr vand, tiltrækkes af hinanden, eller ionbindinger mellem positivt og negativt ladede sidegrupper kan være med til at stabilisere strukturen.

    I modsætning til α-helixers meget kompakte struktur er β-sheets udstrakte (se figur 8). β-sheets udgøres af en eller flere β-strenge og stabiliseres, ligesom α-helixer, af hydrogenbindinger. β-strenge, der ligger ved siden af hinanden i et β-sheet, kan forløbe i samme retning, hvorved de siges af være parallelle, eller i modsat retning, hvorved de siges at være anti-parallelle.

    Både α-helixer og β-sheets er strukturelementer, der ses i AMP’er, som en del af deres sekundærstruktur. Af de naturligt forekomne AMP’er findes der flest α-helix peptider. α-helix peptiderne  er oftest ustruktureret i vandig opløsning, men når de nærmer sig og begynder at interagere med bakterielle cellemembraner, vil peptiderne folde sig sammen i en amfipatisk alfa-helix, hvor den ene del af helixen hovedsageligt udgøres af hydrofobiske aminosyrer, mens den modsatte del udgøres af positivt ladede aminosyrer. α-helix peptiderne har ikke en konserveret aminosyresekvens, dvs. der er stor variation i sekvensen i de forskellige peptider. Der er dog stor lighed i måden, hvorpå peptiderne ordner sig og adskiller hydrofobe aminosyrer fra ladede aminosyrer, når de kommer i kontakt med bakteriers overflade. Denne strukturering er vigtig for peptidernes funktion, idet det er den positivt ladede del af AMP’et, der binder sig til bakteriens negativt ladede overflade. Efterhånden som der kommer flere peptider til cellens overflade, vil de begynde at bore sig ned i cellemembranen, hvorved de sammen danner en transmembran (membrangennemborende) kanal (se figur 9). Her er den hydrofobe del af AMP’et vigtig, idet denne del vender ind mod cellemembranen og interagerer med membranens hydrofobe fedtsyrer.

    Figur 7Alfa-helixen er formet som en spiral og har 3,6 aminosyrer pr. omdrejning.

    Figur 8β-strenge, der ligger ved siden af hinanden i et β-sheet, kan enten være parallelle eller antiparallelle.

    Udover primær- og sekundærstrukturen af proteiner har de en tertiærstruktur, der defineres som den rumlige struktur af et proteinmolekyles atomer uden hensynstagen til andre proteinmolekyler. α-helixer og β-sheets bidrager til tertiærstrukturen, idet visse dele af det samlede proteinmolekyle har disse strukturer. Interaktioner mellem de forskellige aminosyrer og deres sidekæder i polypeptidkæden har betydning for tertiærstrukturen. Tertiærstrukturen bestemmes ofte af hydrogenbindinger, interaktioner mellem hydrofobiske sidekæder, ionbindinger mellem positivt og negativt ladede sidekæder og af de tidligere omtalte disulfidbindinger mellem specielle cysteinsidekæder. For proteiner der befinder sig i vandige opløsninger, f.eks. cellens cytoplasma, vil det være naturligt, at de folder sig således, at deres hydrofile aminosyrer vender ud mod vandet. Inderst inde i proteinet vil de hydrofobe aminosyrer samles og interagere med hinanden. Dette vil give den mest stabile struktur, idet de aminosyrer, der ikke kan ”lide” vand, er ”gemt” inde i proteinet. AMP’er vil derimod strukturere sig således, at når de befinder sig nede i cellemembranen og har dannet en transmembran kanal, vil de hydrofobe aminosyrer vende ind mod cellemembranen, mens de hydrofile aminosyrer vil vende ud mod kanalen.

    Figur 9Figuren illustrerer den negativt ladede bakterielle membranoverflade, som AMP’er, på det første billede, binder sig til. AMP’erne tiltrækkes den bakterielle cellemembran på grund af deres positive ladning og kan efterfølgende bore sig ned i membranen og sætte sig dér, hvilket ses på det tredje billede.

    Mange funktionelle proteiner består ikke kun af én polypeptidkæde, men derimod af to eller flere polypeptidkæder. Disse kaldes subunits, og hver af dem har en unik tertiærstruktur. Proteinets kvartenærstrukur beskriver, hvordan de forskellige polypeptidkæder, eller subunits, vekselvirkninger med hinanden i et funktionelt proteinkompleks. Proteinets kvartenære struktur holdes sammen af svage bindinger (hydrogenbindinger og hydrofobe vekselvirkninger) samt disulfidbindinger. I mange store, komplekse proteiner vil de forskellige subunits have forskellige funktioner. I nogle proteiner vil man eksempeltvis se, at én subunit er en regulatorisk subunit, der regulerer proteinaktiviteten, mens en anden er en katalytisk subunit, der katalyserer den ønskede reaktion.

    AMP’er er meget små molekyler og består kun af en enkel peptidkæde. De har derved ikke i sig selv en kvartenærstruktur. Når AMP’er binder sig til celler vil de finde sammen og danne en transmembran kanal. Eksempeltvis kan nævnes AMP’et trichotoxin (se figur 10), der ved kontakt med cellemembranen danner en transmembran kanal i sæt af 8 identiske peptider. De 8 identiske trichotoxin peptider har derved bundet sig sammen i en kvartenærstruktur. Den hydrofobe del af hvert AMP vender nu ud mod cellemembranen, mens den hydrofile del vil vende ind mod kanalen, der dannes. Det er dermed sekundærstrukturen, der bestemmer, hvor godt AMP’er binder sig til cellemembranen til at starte med, mens det er kvarternærstrukturen, der medfører celledød. Det ses herved, at det er vigtigt at omtale proteinstruktur på flere niveauer for at forstå AMP’ers specfikke virkningsmekanisme.

    Figur 10Når AMP’et, trichotoxin, har bundet sig til cellemembranen, vil 8 identiske peptider danne en transmembran kanal. Trichotoxin peptider sidder herefter i en kvartenærstruktur i cellemembranen.

    Et af problemerne ved at benytte antimikrobielle peptider som lægemidler er, at de er proteiner, hvorved de let kan nedbrydes i kroppen af enzymer, der kaldes proteaser. Disse enzymer er stand til at bryde bindingerne mellem aminosyrerne i peptidkæden af AMP’erne. I forbindelse med udvikling af AMP’er som lægemidler er det derfor vigtigt at teste stabiliteten af peptiderne i blodet. Udformning af strategier til at stabilisere AMP’er over for proteaser er en vigtig del af det strukturelle design af peptiderne. En simpel lineær α-helix struktur er relativt følsom over for proteolyse, dvs. nedbrydning af proteaser. Når AMP’er skal designes og bruges som lægemidler, er det derved essentielt at introducere disulfidbindinger, som gør dem mere rigide og bedre i stand til at modstå nedbrydning.

    De 20 aminosyrer

    De 20 forskellige aminosyrer er inddelt i undergrupper, alt efter om de er hydrofile, hydrofobe eller specielle. Aminosyrer har både tre-bogstavs- og et-bogstavsforkortelser. 

    Nutidens store forbrug af antibiotika har bevirket, at antallet af antibiotikaresistente bakterier er steget kraftigt de seneste år (det store antibiotikaforbrug illustreres på figur 1). Problemer med multiresistente bakterier vokser, og dette kan i høj grad begrænse mulighederne for i fremtiden at bekæmpe bakterielle infektioner. I dag forskes der derfor i måder, hvorpå man kan bekæmpe bakterier, der enten allerede er blevet resistente over for antibiotika på markedet eller kan risikere at blive resistente. Vi er på jagt efter nye antibiotika, der kan bekæmpe bakterieinfektioner effektivt uden en hurtig udvikling af antibiotikaresistens. Inden for de seneste årtier har forskere opdaget, at antimikrobielle peptider (AMP’er) har dette potentiale. AMP’er produceres af flercellede organismer som en forsvarsmekanisme over for sygdomsfremkaldende mikroorganismer. Idet AMP’er er en del af vores immunforsvar, er bakterier gennem mange millioner af år blevet udsat for disse. Der er dog ikke blevet observeret udbredt resistens over for AMP’er, hvilket gør dem interessante inden for forskningsverdenen, idet de potentielt kan benyttes som fremtidens antibiotika.

    Før vi ser nærmere på AMP’er, lad os starte med at undersøge, hvorfor resistens egentlig er så stort et globalt problem, og hvilke mekanismer der ligger bag udviklingen af resistens.

    Figur 1. På figuren ses, at der er en sammenhæng mellem procentdelen af resistente bakteriestammer og mængden af antibiotika der forbruges.

    Antibiotikaresistens er på mange måder et stort globalt problem. Infektioner forårsaget af resistente bakterier kan oftest ikke behandles med almindelige behandlingsmetoder, hvilket resulterer i vedvarende infektion og større risiko for død. Er bakterien kun resistent mod et antibiotikum kan et andet bruges, men bliver bakterien resistent mod mange typer, kan det være svært eller helt umuligt at slå infektionen ned. Idet infektioner med resistente bakterier varer længere tid, vil der potentielt kunne spredes resistente mikroorganismer til flere mennesker. Grundet stigningen i antallet af antibiotikaresistente bakterier de seneste årtier (figur 2) er der fare for, at mange infektionssygdomme ikke længere kan kontrolleres. Derudover må dyrere behandlingsformer ofte tages i brug, når bakterielle infektioner bliver resistente over for first-line medikamenter, hvilket er en belastning på samfundsøkonomien.

    Flere mekanismer kan være årsag til udviklingen af antibiotikaresistens. Der kan forekomme en ændring i en bakteries gener, hvilket kan medføre, at bakterien har nemmere ved at bekæmpe antibiotika. Denne ændring kaldes en mutation. Mutationer kan gøre bakterien bedre i stand til at modstå antibiotika, hvorved denne bakterie har mulighed for at formere sig og producere flere resistente bakterier.

    Figur 2Denne graf viser antallet af rapporteredetilfælde af methicillin (et antibiotikum) resistente Staphylococcus aureus (MRSA) i Danmark i årene fra 1994 til 2011. Fra DANMAP rapporten fra 2011.

     

    Hvis antibiotikummet har til opgave at binde til et enzym og forhindre det i at udøve sin funktion, kunne en mutation ændre enzymet, så det ikke længere kan genkende det antibakterielle stof. Herved vil enzymet ikke længere blive forhindret i at udøve sin effekt, og den bakterielle infektion vil vare ved. Mutationer kan også resultere i en mindsket permeabilitet (gennemtrængelighed) af cellemembranen over for antibiotika eller en produktion af nye enzymer, der kan nedbryde det tilførte lægemiddel. Proteiner på den ydre cellemembran af nogle Gram-negative bakterier (se artikel om inddeling af bakterier i Gram-negative og Gram-positive) kan pumpe antibiotika ud af cellen, hvilket nedsætter dets effektivitet. Ydermere, kan der forekomme mutationer i receptorer på bakteriecellens overflade, som antibiotika skal binde sig til, hvorved antibiotikummet ikke har nogen virkning. Antibiotikaresistens kan overføres fra én bakterie til en anden. Dette kan ske på to forskellige måder. DNA fra én bakterie kan overføres til en anden vha. en bakteriel virus. Derudover kan bakterier overføre genetisk materiale direkte til hinanden ved at bygge en bro mellem dem. Den sidstnævnte måde, hvorpå resistens kan overføres, benyttes hovedsageligt af Gram-negative bakterier. Modtagercellen vil på begge måder arve resistensen og være klar til at modstå behandlinger med antibiotika.

    Når der indtages antibiotika vil det dræbe de tilstedeværende bakterier, men hvis nogle af bakterierne er resistente, vil disse overleve og formere sig. Man kunne tro, at det er tilstedeværelsen af antibiotika, der gør, at bakterierne ændrer sig og muterer en del af deres struktur, hvorved de kan modstå antibiotikummet. Sandheden er dog, at mutationer forekommer uafhængigt af antibiotikummet. Hvis en bakteriecelle har muteret sig og overlever, når der er antibiotika til stede, vil denne celle dele sig, og alle bakteriecellens efterkommere vil arve denne mutation. Mutationer forekommer altså helt af sig selv i naturen. For bakterien E. coli antages det, at der forekommer én mutation for hver 1.000.000 bakterier. Denne mutation kan eventuelt medføre, at bakterien bliver resistent over for et bestemt antimikrobielt stof. Heraf ses det, at kun en meget lille procentdel af alle bakterierne bliver naturligt resistente, men da bakterier vokser og formerer sig meget hurtigt, vil den muterede, resistente bakterie også formere sig. Således vil der komme flere bakterier, der udviser resistens over for det antimikrobielle stof.

    Man har længe kendt til forekomsten af naturlige mutationer, hvilket er grunden til, at patienter, der tager antibiotika for at bekæmpe en bakteriel infektion, altid skal fuldende behandlingen, selvom symptomerne er væk. På denne måde sikrer man, at alle bakterier dør eller forhindres i at formere sig, hvorefter kroppens eget immunsystem kan tage sig af de få tilbageværende celler, resistente som ikke-resistente. Hvis behandlingen derimod afbrydes for tidligt, vil kroppens forsvarsmekanismer have problemer med at bekæmpe de resterende bakterier. Hvis nogle af disse er resistente, vil de have mulighed for at formere sig, hvilket resulterer i en ny infektion, der denne gang ikke kan behandles af det oprindeligt benyttede antibiotikum.

    Moderne antibiotika har et begrænset antal makromolekylære ’targets’, som oftest er essentielle bakterielle proteiner. Det vil sige, at de antibiotika, der er på markedet i dag, kun har få virkningsmekanismer og virker derved kun på få dele af bakterien. AMP’er har derimod mange flere virkningsmekanismer og kan angribe bakterien på flere forskellige måder. Bakterien har derved sværere ved at udvikle resistens over for AMP’er end moderne antibiotika, da der er flere virkningsmekanismer, der skal bekæmpes. Derudover er AMP’ers primære virkningsmekanisme at lave huller i cellemembranen, hvorved livsvigtige molekyler og ioner kan slippe ud af cellen. Da AMP’er er specifikke over for en så fundamental del af cellen som dennes membran, er sandsynligheden for, at der udvikles resistens, minimal. Det ville kræve meget af bakterien, hvis den skulle til at ændre sin cellemembran og udvikle en resistensmekanisme til at bekæmpe AMP’ers membranødelæggende effekt.

    AMP’er har altid været en vigtig del af vores immunforsvar og har udviklet sig sideløbende med bakterier, uden at bakterier er blevet udbredt resistente. De seneste år har vi derved fået øjnene op for AMP’er som potentielle lægemidler, idet udvikling af resistens over for disse tænkes at være usandsynlig. Det er vigtigt, at dette bliver ved med at være tilfældet, da det kan have alvorlige konsekvenser for immunsystemet og dets aktivitet, hvis bakterier udvikler resistensmekanismer over for AMP’er. Hvis bakterier udviklede resistensmekanismer over for immunsystemets AMP’er, ville vores immunforsvar pludselig have meget sværere ved at beskytte os mod bakterielle infektioner.

    Selvom udvikling af resistens over for AMP’er er begrænset, har det vist sig, at både Gram-positive og Gram-negative bakterier kan benytte sig af flere forskellige mekanismer til at modstå AMP’er (jf. figur 3). Bakterier kan ændre deres celleoverflade ved enten at ændre ladningen og gøre overfladen mere positiv, hvilket vil frastøde de kationiske AMP’er, eller mindske permeabiliteten (gennemtrængeligheden) af cellemembranen over for AMP’erne. Derudover kan bakterierne fjerne AMP’er ved brug af diverse efflux transportører, de kan udtrykke proteaser, der nedbryder AMP’erne, eller de kan mindske værtens produktion af AMP’er.

    Vi må holde for øje, at det ikke er umuligt for bakterier at udvikle resistens over for AMP’er, og denne overvejelse skal med, når AMP’er skal designes og bruges som lægemidler.

    Figur 3Figuren viser de forskellige resistensmekanismer, som bakterier bruger til at modstå AMP’er.

    Når proteiner er blevet transkriberet og translateret inde i cellen, kan de have mange forskellige destinationer i eller uden for cellen (artikel om transkription, translation og det centrale dogme fås ved at klikke her) . For at guide dem hen til det rigtige sted, har de fleste proteiner et signalpeptid siddende på sig. Dette signalpeptid medfører, at AMP’er secerneres, dvs. udskilles fra cellen, hvilket er vigtigt, da de udøver deres effekt uden for cellen. Derudover består AMP’er også af en propeptid del der, ligesom signalpeptidet, klippes af, før det sendes ud af cellen. Før propeptidet klippes af, er AMP’et ikke aktivt.

    Figur 1Figuren viser opbygningen af et protein med signalpeptid og propeptid, der begge klippes af for at danne det aktive protein.

    AMP’et aktiveres derved først, når propeptidet klippes af, hvilket er smart, da AMP’er er potentielt selvskadelige. De skal derved kun være aktive uden for cellen, og når der er brug for dem, dvs. når der er bakterier til stede.
    Signalpeptidet, der medfører, at AMP’er secerneres findes altid i starten (den N-terminale ende) af peptidet (figur 1).

    Signalpeptidet opfattes af cellen ved, at et specifikt signal-genkendelsesmolekyle (signal recognition particle (SRP)) bindes til signalpeptidet på det nye protein. Når SRP er bundet til signalpeptidet, vil translationen af mRNA til protein midlertidigt stoppe. SRP og det ufærdige protein vil dernæst bevæge sig hen til det ru endoplasmatiske retikulum (ruER) (figur 2), hvor SRP binder til en SRP-receptor på det ruER. Grunden til, at det kaldes det ru ER er, at der sidder ribosomerpå det, hvorved overfladen ser ujævn ud. Derudover sidder der ribosombindende receptorer på det ruER, hvilke ikke er til stede på det glatte ER. Ribosomreceptorerne binder ribosomerne, hvortil der er bundet det ufærdige protein og signalpeptid. Når SRP er bundet til en SRP-receptor på det ruER samtidig med, at ribosomet er bundet til en ribosomreceptor, kan translationen genoptages. Translationen færdiggøres, hvorefter ribosomet vil falde af det ruER. Ribosomet kan nu binde et nyt stykke mRNA, der skal translateres.

    Figur 2Det ru endoplasmatiske retikulum (ruER), hvortil ribosomer er bundet, indgår i syntesen af proteiner, modificering af proteiner og dannelsen af cellemembranen.

    Idet SRP binder til en SRP-receptor på det ruER, vil SRP frigøres, hvorefter translationen kan fortsætte.  Det nye peptid syntetiseres direkte ind i det ruER. Inde i ER findes enzymet, signalpeptidase, der klipper signalpeptidet af proteinet. Dét sted, hvor signalpeptidasen klipper signalpeptidet fra, kaldes for kløvningssitet. Når signalpeptidet er blevet klippet fra, er peptidet klar til videre distribution i cellen eller til videre transport ud af cellen via golgiapparatet (figur 3). Peptidet vil blive transporteret af transportvesikler fra det ruER til cis siden af golgiapparatet. I golgiapparatet kan der evt. ske videre modifikation af peptidet. Dernæst vil peptidet blive transporteret i vesikler ud til cellemembranen, hvor de via exocytosebliver secerneret ud af cellen.

    Som tidligere beskrevet, er det vigtigt at AMP’er har en signalsekvens, der dirigerer dem ud af cellen. Dette skyldes, at AMP’er udøver deres effekt uden for cellen, hvor de skal slå mikrober ihjel. Center for Biologisk Sekvens Analyse (CBS) ved Institut for Systembiologi på DTU benytter sig af bioinformatik og har udviklet et program, SignalP, som kan forudsige signalpeptider og deres kløvningssites.

    Figur 3Figuren viser en del af en celle og nogle af organellerne, der findes i cytoplasma. Golgiapparatet ses på højre side af figuren. Dets primære funktion er at færdiggøre proteiner, så de er klar til eksport ud af cellen.

    Inden for bioinformatikken findes der mange forskellige værktøjer, som kan benyttes hvis man er på udkig efter nye AMP’er. En strategi kunne være at lede efter peptider, hvortil signalpeptider er bundet, og derefter se om disse peptider er AMP’er. Man gør herved sin søgning efter AMP’er meget simplere, idet man først identificerer proteiner med signalpeptider, før man begynder at lede efter AMP’er blandt disse. Tænk på, at der er mange tusinde gener i eukaryoter, så hvis man vil finde nye AMP’er til medicinsk forskning, er det noget lettere, hvis man kun leder efter AMP’er blandt de gener, der secerneres. Proteiner, der secerneres, er kun en brøkdel af det samlede antal proteiner i cellen. Man kan herefter bruge SignalP til at verificere tilstedeværelsen af et signalpeptid og afgøre, hvor kløvningssitet for signalpeptidet sidder. Det ses herved, at man ved simpel hjælp fra bioinformatikken kan reducere sin AMP-eftersøgning ganske dramatisk i de ellers uoverskuelige store mængder af DNA sekvenser.

    For at demonstrere hvordan bioinformatik kan tages i brug, kan du selv prøve at benytte SignalP til at forudsige positionen af kløvningssitet for et signalpeptid siddende på et AMP. Lad os vælge at undersøge Plectasin, som blev opdaget af Novozymes i 2002 og viste sig at være et meget lovende antibiotikum, der var effektivt mod multiresistente bakterier.

    Gå først til SignalP ved at klikke her.

    Nedenfor ses aminosyresekvensen for Plectasin. Kopier denne og sæt den ind i det tomme felt i SignalP.

    MQFTTILSIGITVFGLLNTGAFAAPQPVPEAYAVSDPEAHPDDFAGMDANQLQKRG
    FGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY

     

    Klik herefter ’Submit’ og læs resultaterne igennem. Hvad står der om signalsekvensen, og efter hvilken aminosyre i sekvensen findes kløvningssitet? Hvad står der efter ”Cleavage site between…”?

    Vi kan undersøge om programmet har fundet det rigtige kløvningssite ved at benytte programmet UniProt. I søgefeltet skrives ’Plectasin’, hvorved der fås et enkelt hit, som hedder Q53I06 (PLECT_PSENR). Klik på dette hit og kig under Sequence annotation (Features), hvor du finder en liste over længden (antal aminosyrer i sekvensen) af signalpeptidet, propeptidet og den aktive peptidkæde. Her kan du se, om længden af signalpeptidet stemmer overens med dét, du fandt ved at benytte SignalP.

null

Projektet er udarbejdet af Emma Christine Jappe. Emma læser til daglig civilingeniør i Anvendt Kemi.

Emma Christine Jappe

null

Institut for Systembiologi har Danmarks største biovidenskabelige og bioteknologiske forskning på universitetsniveau.
Instituttet har været partner og sponsor på projektet.

Institut for Systembiologi